FAM23A (TMEM236) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TMEM236 antibody is: synthetic peptide directed towards the middle region of Human TMEM236. Synthetic peptide located within the following region: YPLRGSQKSSENGHIHSTSLQHIKTVTEQVRQSPENAASPQATNSTQVSQ
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	transmembrane protein 236
Database Link	NP_001092314 Entrez Gene 653567 Human UniProt ID Q5W0B7
Background	The function of this protein remains unknown.
Synonyms	bA16O1.2; bA162I21.2; FAM23A; FAM23B
Note	Human: 100%; Pig: 75%; Horse: 75%; Bovine: 75%; Guinea pig: 75%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.