CD300 (CD300LF) Rabbit Polyclonal Antibody
CAT#: TA330859
Rabbit Polyclonal Anti-CD300LF Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-CD300LF antibody is: synthetic peptide directed towards the middle region of Human CD300LF. Synthetic peptide located within the following region: IWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYW |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 26 kDa |
Gene Name | CD300 molecule like family member f |
Database Link | |
Background | CD300LF is an inhibitory receptor of the Ig superfamily expressed on myeloid cells. It mediates negative regulatory signals by recruiting SHP1 or SHIP. |
Synonyms | CD300f; CLM-1; CLM1; IgSF13; IREM-1; IREM1; LMIR3; NKIR |
Note | Human: 100% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |