SLC35E2B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC35E2B antibody is: synthetic peptide directed towards the N-terminal region of Human SLC35E2B. Synthetic peptide located within the following region: SVKTPALEELVPGSEEKPKGRSPLSWGSLFGHRSEKIVFAKSDGGTDENV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	solute carrier family 35 member E2B
Database Link	NP_001104251 Entrez Gene 728661 Human UniProt ID P0CK96
Background	SLC35E2B is a putative transporter.
Synonyms	SLC35E2
Note	Human: 100%; Dog: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.