VN1R4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-VN1R4 antibody is: synthetic peptide directed towards the C-terminal region of Human VN1R4. Synthetic peptide located within the following region: LGLMLWVSSSMVCILHRHKQRVQHIDRSDLSPRASPENRATQSILILVST
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	vomeronasal 1 receptor 4
Database Link	NP_776256 Entrez Gene 317703 Human UniProt ID Q7Z5H5
Background	VN1R4 is a putative pheromone receptor.
Synonyms	V1RL4
Note	Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 92%; Horse: 86%; Goat: 85%; Pig: 77%; Sheep: 77%; Bovine: 77%; Guinea pig: 77%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.