TMPRSS11F Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TMPRSS11F antibody is: synthetic peptide directed towards the C-terminal region of Human TMPRSS11F. Synthetic peptide located within the following region: IILHENYHRETNENDIALVQLSTGVEFSNIVQRVCLPDSSIKLPPKTSVF
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	transmembrane protease, serine 11F
Database Link	NP_997290 Entrez Gene 389208 Human UniProt ID Q6ZWK6
Background	TMPRSS11F is a probable serine protease.
Synonyms	FLJ16046
Note	Dog: 100%; Horse: 100%; Human: 100%; Pig: 93%; Rabbit: 93%; Mouse: 86%; Bovine: 86%; Rat: 79%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.