TMEM177 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TMEM177 antibody is: synthetic peptide directed towards the C-terminal region of Human TMEM177. Synthetic peptide located within the following region: AYACGGVEFYEKLLSGNLALRSLLGKDGEKLYTPSGNIVPRHLFRIKHLP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	transmembrane protein 177
Database Link	NP_085054 Entrez Gene 80775 Human UniProt ID Q53S58
Background	The function of this protein remains unknown.
Synonyms	MGC10993
Note	Rat: 100%; Human: 100%; Dog: 86%; Pig: 86%; Mouse: 86%; Guinea pig: 86%; Horse: 79%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.