TMED6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TMED6 antibody is: synthetic peptide directed towards the C-terminal region of Human TMED6. Synthetic peptide located within the following region: FGVFYEGPETDHKQKERKQLNDTLDAIEDGTQKVQNNIFHMWRYYNFARM
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	transmembrane p24 trafficking protein 6
Database Link	NP_653277 Entrez Gene 146456 Human UniProt ID Q8WW62
Background	The function of this protein remains unknown.
Synonyms	p24g5; PRO34237; SPLL9146
Note	Human: 100%; Pig: 86%; Horse: 86%; Rabbit: 86%; Dog: 80%; Rat: 79%; Mouse: 79%; Bovine: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.