TMED5 Rabbit Polyclonal Antibody
CAT#: TA330775
Rabbit Polyclonal Anti-TMED5 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-TMED5 antibody is: synthetic peptide directed towards the C-terminal region of Human TMED5. Synthetic peptide located within the following region: INSIKSRLSKSGHIQTLLRAFEARDRNIQESNFDRVNFWSMVNLVVMVVV |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 23 kDa |
Gene Name | transmembrane p24 trafficking protein 5 |
Database Link | |
Background | TMED5 is a potential role in vesicular protein trafficking, mainly in the early secretory pathway. It is required for the maintenance of the Golgi apparatus; involved in protein exchange between Golgi stacks during assembly. It probably not required for COPI-vesicle-mediated retrograde transport. |
Synonyms | CGI-100; p24g2; p28 |
Note | Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |