SHCBP1 Rabbit Polyclonal Antibody
CAT#: TA330750
Rabbit Polyclonal Anti-SHCBP1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SHCBP1 antibody is: synthetic peptide directed towards the C-terminal region of Human SHCBP1. Synthetic peptide located within the following region: IPKISMVNNIIHNNEGYGVVLVKPTIFSDLQENAEDGTEENKALKIQTSG |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 75 kDa |
Gene Name | SHC binding and spindle associated 1 |
Database Link | |
Background | SHCBP1 may play a role in signaling pathways governing cellular proliferation, cell growth and differentiation. It may be a component of a novel signaling pathway downstream of Shc. |
Synonyms | PAL |
Note | Human: 100%; Pig: 93%; Rabbit: 86%; Bovine: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |