SHCBP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SHCBP1 antibody is: synthetic peptide directed towards the C-terminal region of Human SHCBP1. Synthetic peptide located within the following region: IPKISMVNNIIHNNEGYGVVLVKPTIFSDLQENAEDGTEENKALKIQTSG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	75 kDa
Gene Name	SHC binding and spindle associated 1
Database Link	NP_079021 Entrez Gene 79801 Human UniProt ID Q8NEM2
Background	SHCBP1 may play a role in signaling pathways governing cellular proliferation, cell growth and differentiation. It may be a component of a novel signaling pathway downstream of Shc.
Synonyms	PAL
Note	Human: 100%; Pig: 93%; Rabbit: 86%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.