ARMC5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ARMC5 antibody is: synthetic peptide directed towards the N-terminal region of Human ARMC5. Synthetic peptide located within the following region: GEAGEEEEEGREAASWDFPEERTPERAQGGSFRSLRSWLISEGYATGPDD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	63 kDa
Gene Name	armadillo repeat containing 5
Database Link	NP_079018 Entrez Gene 79798 Human UniProt ID Q96C12
Background	The function of this protein remains unknown.
Synonyms	AIMAH2
Note	Human: 100%; Dog: 93%; Pig: 86%; Rat: 86%; Horse: 86%; Bovine: 86%; Guinea pig: 86%; Rabbit: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.