CCDC121 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CCDC121 antibody is: synthetic peptide directed towards the middle region of Human CCDC121. Synthetic peptide located within the following region: QLLEESRELHREKLLVQAENRFFLEYLTNKTEEYTEQPEKVWNSYLQKSG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	coiled-coil domain containing 121
Database Link	NP_001136155 Entrez Gene 79635 Human UniProt ID Q6ZUS5
Background	The function of this protein remains unknown.
Synonyms	FLJ13646; FLJ43364
Note	Human: 100%; Yeast: 100%; Dog: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.