NDNF Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-NDNF antibody is: synthetic peptide directed towards the N-terminal region of Human NDNF. Synthetic peptide located within the following region: LEWKLSLQELPEDRSGEGSGDLEPLEQQKQQIINEEGTELFSYKGNDVEY
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	62 kDa
Gene Name	neuron-derived neurotrophic factor
Database Link	NP_078850 Entrez Gene 79625 Human UniProt ID Q8TB73
Background	NDNF promotes matrix assembly and cell adhesiveness. It promotes neuron migration, growth and survival as well as neurite outgrowth.
Synonyms	C4orf31; NORD
Note	Human: 100%; Pig: 86%; Zebrafish: 76%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.