TRAPPC6A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TRAPPC6A antibody is: synthetic peptide directed towards the N-terminal region of Human TRAPPC6A. Synthetic peptide located within the following region: HDPDPGPGVSAGLRGEEAGATKGQKMSLSVLEGMGFRVGQALGERLPRET
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	19 kDa
Gene Name	trafficking protein particle complex 6A
Database Link	NP_077013 Entrez Gene 79090 Human UniProt ID O75865
Background	This gene encodes a component of the trafficking protein particle complex, which tethers transport vesicles to the cis-Golgi membrane. Loss of expression of the related gene in mouse affects coat and eye pigmentation, suggesting that the encoded protein may be involved in melanosome biogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Synonyms	TRS33
Note	Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.