C2orf49 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C2orf49 antibody is: synthetic peptide directed towards the middle region of Human C2orf49. Synthetic peptide located within the following region: VDGLRKRPLIVFDGSSTSTSIKVKKTENGDNDRLKPPPQASFTSNAFRKL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	chromosome 2 open reading frame 49
Database Link	NP_076998 Entrez Gene 79074 Human UniProt ID Q9BVC5
Background	The function of this protein remains unknown.
Synonyms	asw
Note	Human: 100%; Bovine: 100%; Rat: 93%; Horse: 93%; Rabbit: 93%; Dog: 92%; Pig: 92%; Guinea pig: 92%; Mouse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.