C1orf135 (AUNIP) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-AUNIP antibody is: synthetic peptide directed towards the N-terminal region of Human AUNIP. Synthetic peptide located within the following region: RAPSTGIHQRSIASFFTLQPGKTNGSDQKSVSSHTESQINKESKKNATQL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	aurora kinase A and ninein interacting protein
Database Link	NP_076942 Entrez Gene 79000 Human UniProt ID Q9H7T9
Background	AUNIP is required for the dynamic movement of AURKA at the centrosomes and spindle apparatus during the cell cycle.
Synonyms	AIBP; C1orf135
Note	Human: 100%; Pig: 86%; Horse: 86%; Rabbit: 85%; Dog: 79%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.