TMBIM1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TMBIM1 antibody is: synthetic peptide directed towards the N-terminal region of Human TMBIM1. Synthetic peptide located within the following region: GYGHPAGYPQPMPPTHPMPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	transmembrane BAX inhibitor motif containing 1
Database Link	NP_071435 Entrez Gene 64114 Human UniProt ID Q969X1
Background	TMBIM1 negatively regulates aortic matrix metalloproteinase-9 (MMP9) production and may play a protective role in vascular remodeling.
Synonyms	LFG3; MST100; MSTP100; PP1201; RECS1
Note	Human: 100%; Pig: 93%; Guinea pig: 93%; Horse: 92%; Bovine: 92%; Dog: 86%; Rabbit: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.