Pdzd4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Pdzd4 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Pdzd4. Synthetic peptide located within the following region: SEMKMGRYWSKEERKQHLIRAREQRKRREFMMQSRLECLREQQNGDSKPE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	86 kDa
Gene Name	PDZ domain containing 4
Database Link	NP_001025039 Entrez Gene 245469 Mouse UniProt ID Q9QY39
Background	The function of this protein remains unknown.
Synonyms	FLJ34125; KIAA1444; LU1; PDZK4; PDZRN4L
Note	Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.