SERTAD4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SERTAD4 antibody is: synthetic peptide directed towards the C-terminal region of Human SERTAD4. Synthetic peptide located within the following region: VGNDLAFECKGQFYDYFETGYNERNNVNESWKKSLRKKEASPPSNKLCCS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	SERTA domain containing 4
Database Link	NP_062551 Entrez Gene 56256 Human UniProt ID Q9NUC0
Background	The function of this protein remains unknown.
Synonyms	DJ667H12.2
Note	Human: 100%; Dog: 86%; Rat: 86%; Horse: 86%; Bovine: 86%; Rabbit: 83%; Pig: 80%; Guinea pig: 80%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.