C1orf112 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C1orf112 antibody is: synthetic peptide directed towards the C-terminal region of Human C1orf112. Synthetic peptide located within the following region: TEAAKVERVKQEKGIFWEPFANVTVEEAKRSSLQPYAKRARQEFPWEEEY
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	78 kDa
Gene Name	chromosome 1 open reading frame 112
Database Link	NP_060656 Entrez Gene 55732 Human UniProt ID Q9NSG2
Background	The function of this protein remains unknown.
Synonyms	RP1-97P20.1
Note	Human: 100%; Pig: 86%; Dog: 85%; Horse: 85%; Bovine: 77%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.