NDUFAF7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-NDUFAF7 antibody is: synthetic peptide directed towards the C-terminal region of Human NDUFAF7. Synthetic peptide located within the following region: LGPIKQHTFLKNMGIDVRLKVLLDKSNEPSVRQQLLQGYDMLMNPKKMGE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	NADH:ubiquinone oxidoreductase complex assembly factor 7
Database Link	NP_001077415 Entrez Gene 55471 Human UniProt ID Q7L592
Background	The function of this protein remains unknown.
Synonyms	C2orf56; MidA; PRO1853
Note	Human: 100%; Pig: 93%; Guinea pig: 93%; Dog: 91%; Mouse: 83%; Rat: 79%; Horse: 79%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.