AP1AR Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-AP1AR antibody is: synthetic peptide directed towards the C-terminal region of Human AP1AR. Synthetic peptide located within the following region: DSTSLDLEWEDEEGMNRMLPMRERSKTEEDILRAALKYSNKKTGSNPTSA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	adaptor related protein complex 1 associated regulatory protein
Database Link	NP_061039 Entrez Gene 55435 Human UniProt ID Q63HQ0
Background	AP1AR is necessary for AP-1 dependent transport between the trans-Golgi network and endosomes. It regulates the membrane association of AP1G1/Gamma1-adaptin, one of the subunits of the AP-1 adapter complex. The direct interaction with AP1G1/Gamma1-adaptin attenuates the release of the AP-1 complex from membranes.
Synonyms	2C18; C4orf16; gamma-BAR; GBAR; PRO0971
Note	Human: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Mouse: 86%; Rabbit: 86%; Horse: 83%; Rat: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.