AP1AR Rabbit Polyclonal Antibody
CAT#: TA330683
Rabbit Polyclonal Anti-AP1AR Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-AP1AR antibody is: synthetic peptide directed towards the C-terminal region of Human AP1AR. Synthetic peptide located within the following region: DSTSLDLEWEDEEGMNRMLPMRERSKTEEDILRAALKYSNKKTGSNPTSA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 34 kDa |
Gene Name | adaptor related protein complex 1 associated regulatory protein |
Database Link | |
Background | AP1AR is necessary for AP-1 dependent transport between the trans-Golgi network and endosomes. It regulates the membrane association of AP1G1/Gamma1-adaptin, one of the subunits of the AP-1 adapter complex. The direct interaction with AP1G1/Gamma1-adaptin attenuates the release of the AP-1 complex from membranes. |
Synonyms | 2C18; C4orf16; gamma-BAR; GBAR; PRO0971 |
Note | Human: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Mouse: 86%; Rabbit: 86%; Horse: 83%; Rat: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |