RNF182 Rabbit Polyclonal Antibody
CAT#: TA330520
Rabbit Polyclonal Anti-RNF182 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-RNF182 antibody: synthetic peptide directed towards the middle region of human RNF182. Synthetic peptide located within the following region: LSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLY |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 27 kDa |
| Gene Name | ring finger protein 182 |
| Database Link | |
| Background | RNF182 is a multi-pass membrane protein. It contains 1 RING-type zinc finger. The function of RNF182 remains unknown. |
| Synonyms | FLJ40772; MGC33993 |
| Note | Immunogen sequence homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 92%; Bovine: 87% |
| Reference Data | |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
