SPRYD5 (TRIM51) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TRIM51 antibody is: synthetic peptide directed towards the middle region of Human TRIM51. Synthetic peptide located within the following region: PVNPELSAGPITGLLDSLSGFRVDFTLQPERANSHIFLCGDLRSMNVGCD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	tripartite motif-containing 51
Database Link	NP_116070 Entrez Gene 84767 Human UniProt ID Q9BSJ1
Background	The function of this protein remains unknown.
Synonyms	SPRYD5; TRIM51A
Note	Immunogen sequence homology: Human: 100%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.