MARCHF4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MARCH4 antibody: synthetic peptide directed towards the N terminal of human MARCH4. Synthetic peptide located within the following region: GLLKCRCRMLFNDLKVFLLRRPPQAPLPMHGDPQPPGLAANNTLPALGAG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	45 kDa
Gene Name	membrane associated ring-CH-type finger 4
Database Link	NP_065865 Entrez Gene 57574 Human UniProt ID Q9P2E8
Background	MARCH4 is an E3 ubiquitin-protein ligase that may mediate ubiquitination of MHC-I and CD4, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
Synonyms	MARCH-IV; RNF174
Note	Immunogen sequence homology: Horse: 100%; Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Mouse: 85%; Rabbit: 85%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.