GDI2 Rabbit Polyclonal Antibody

CAT#: TA330442

Rabbit Polyclonal Anti-GDI2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human GDP dissociation inhibitor 2 (GDI2), transcript variant 1, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of GDP dissociation inhibitor 2 (GDI2), transcript variant 2
    • 100 ug

CNY 3080.00


Recombinant protein of human GDP dissociation inhibitor 2 (GDI2), transcript variant 1, 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of GDP dissociation inhibitor 2 (GDI2), transcript variant 1
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-GDI2 antibody: synthetic peptide directed towards the C terminal of human GDI2. Synthetic peptide located within the following region: EPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHF
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 51 kDa
Gene Name GDP dissociation inhibitor 2
Background GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion/deletion rearrangements.GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI2 is ubiquitously expressed. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion/deletion rearrangements.
Synonyms HEL-S-46e; RABGDIB
Note Immunogen sequence homology: Chicken: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Guinea pig: 92%; Mouse: 92%; Pig: 92%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...