CHRNA9 Rabbit Polyclonal Antibody

CAT#: TA330425

Rabbit Polyclonal Anti-CHRNA9 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5200.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (2)
Transient overexpression lysate of cholinergic receptor, nicotinic, alpha 9 (CHRNA9)
    • 100 ug

CNY 4840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CHRNA9 antibody: synthetic peptide directed towards the N terminal of human CHRNA9. Synthetic peptide located within the following region: MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVE
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 55 kDa
Gene Name cholinergic receptor nicotinic alpha 9 subunit
Background CHRNA9 is a member of the ligand-gated ionic channel family and nicotinic acetylcholine receptor superfamily. CHRNA9 is a plasma membrane protein that forms homo- or hetero-oligomeric divalent cation channels. It is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea.This gene is a member of the ligand-gated ionic channel family and nicotinic acetylcholine receptor gene superfamily. It encodes a plasma membrane protein that forms homo- or hetero-oligomeric divalent cation channels. This protein is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea. The protein is additionally expressed in keratinocytes, the pituitary gland, B-cells and T-cells.
Synonyms HSA243342; NACHRA9
Note Immunogen sequence homology: Bovine: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Rabbit: 100%; Mouse: 93%; Zebrafish: 80%
Reference Data
Protein Families Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...