CIDE B (CIDEB) Rabbit Polyclonal Antibody
CAT#: TA330407
Rabbit Polyclonal Anti-CIDEB Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CIDEB antibody: synthetic peptide directed towards the middle region of human CIDEB. Synthetic peptide located within the following region: LGPKKVLRELLRWTSTLLQGLGHMLLGISSTLRHAVEGAEQWQQKGRLHS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 25 kDa |
Gene Name | cell death-inducing DFFA-like effector b |
Database Link | |
Background | CIDEB activates apoptosis. |
Synonyms | cell death-inducing DFFA-like effector b |
Note | Immunogen sequence homology: Human: 100%; Pig: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |