MMP10 Rabbit Polyclonal Antibody
CAT#: TA330400
Rabbit Polyclonal Anti-MMP10 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4537.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-MMP10 antibody: synthetic peptide directed towards the N terminal of human MMP10. Synthetic peptide located within the following region: MMHLAFLVLLCLPVCSAYPLSGAAKEEDSNKDLAQQYLEKYYNLEKDVKQ |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 54 kDa |
| Gene Name | matrix metallopeptidase 10 |
| Database Link | |
| Background | Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades proteoglycans and fibronectin. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. |
| Synonyms | SL-2; STMY2 |
| Note | Immunogen sequence homology: Human: 100% |
| Reference Data | |
| Protein Families | Druggable Genome, Protease |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
