RGS3 Rabbit Polyclonal Antibody

CAT#: TA330393

Rabbit Polyclonal Anti-RGS3 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human regulator of G-protein signaling 3 (RGS3), transcript variant 2, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 2
    • 100 ug

CNY 4840.00


Recombinant protein of human regulator of G-protein signaling 3 (RGS3), transcript variant 1, 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 1
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-RGS3 antibody: synthetic peptide directed towards the C terminal of human RGS3. Synthetic peptide located within the following region: KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 101 kDa
Gene Name regulator of G-protein signaling 3
Background RGS3 inhibits signal transduction by increasing the GTPASE activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form.This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTP-ase activating protein which inhibits G-protein mediated signal transduction. The protein is largely cytosolic, but G-protein activation leads to translocation of this protein to the plasma membrane. A nuclear form of this protein has also been described, but its sequence has not been identified. Multiple alternatively spliced transcript variants have been described for this gene but the full-length nature of some transcripts is not yet known.
Synonyms C2PA; RGP3
Note Immunogen sequence homology: Bovine: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Guinea pig: 92%; Rabbit: 92%; Chicken: 76%
Reference Data
Protein Families Druggable Genome
Protein Pathways Axon guidance
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...