CDK3 Rabbit Polyclonal Antibody

CAT#: TA330351

Rabbit Polyclonal Anti-CDK3 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (2)
Transient overexpression lysate of cyclin-dependent kinase 3 (CDK3)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human, Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CDK3 antibody: synthetic peptide directed towards the C terminal of human CDK3. Synthetic peptide located within the following region: NLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVLQRF
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 35 kDa
Gene Name cyclin-dependent kinase 3
Background CDK3 is a member of the cyclin-dependent protein kinase family. The protein promotes entry into S phase, in part by activating members of the E2F family of transcription factors. The protein also associates with cyclin C and phosphorylates the retinoblastoma 1 protein to promote exit from G0.This gene encodes a member of the cyclin-dependent protein kinase family. The protein promotes entry into S phase, in part by activating members of the E2F family of transcription factors. The protein also associates with cyclin C and phosphorylates the retinoblastoma 1 protein to promote exit from G0. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms cyclin-dependent kinase 3
Note Immunogen sequence homology: Human: 100%; Mouse: 93%; Rabbit: 87%; Dog: 86%; Bovine: 81%
Reference Data
Protein Families Druggable Genome, Protein Kinase
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...