TNFRSF18 Rabbit Polyclonal Antibody
CAT#: TA330342
Rabbit Polyclonal Anti-TNFRSF18 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TNFRSF18 antibody: synthetic peptide directed towards the C terminal of human TNFRSF18. Synthetic peptide located within the following region: LHIWQLRKTQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDLWV |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 23 kDa |
Gene Name | tumor necrosis factor receptor superfamily member 18 |
Database Link | |
Background | The protein encoded by TNFRSF18 is a member of the TNF-receptor superfamily. This receptor has been shown to have increased expression upon T-cell activation, and it is thought to play a key role in dominant immunological self-tolerance maintained by CD25(+)CD4(+) regulatory T cells. Knockout studies in mice also suggest the role of this receptor is in the regulation of CD3-driven T-cell activation and programmed cell death.The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to have increased expression upon T-cell activation, and it is thought to play a key role in dominant immunological self-tolerance maintained by CD25(+)CD4(+) regulatory T cells. Knockout studies in mice also suggest the role of this receptor is in the regulation of CD3-driven T-cell activation and programmed cell death. Three alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. |
Synonyms | AITR; CD357; GITR; GITR-D |
Note | Immunogen sequence homology: Human: 100% |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它TNFRSF18产品