SEPTIN4 Rabbit Polyclonal Antibody

CAT#: TA330328

Rabbit Polyclonal Anti-SEPT4 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human septin 4 (SEPT4), transcript variant 1, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of septin 4 (SEPT4), transcript variant 4
    • 100 ug

CNY 3080.00


Recombinant protein of human septin 4 (SEPT4), transcript variant 1, 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of septin 4 (SEPT4), transcript variant 1
    • 100 ug

CNY 4840.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-SEPT4: synthetic peptide directed towards the N terminal of human SEPT4 (septin-4). Synthetic peptide located within the following region: RSLGWQGNSVPEDRTEAGIKRFLEDTTDDGELSKFVKDFSGNASCHPPEA
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 55 kDa
Gene Name septin 4
Background The SEPT4 gene is a member of the septin gene family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse and appear to regulate cytoskeletal organization. SEPT4 encodes a protein that is thought to be part of a complex involved in cytokinesis.
Synonyms ARTS; BRADEION; CE5B3; H5; hCDCREL-2; hucep-7; MART; PNUTL2; SEP4
Note Immunogen sequence homology: Crab-eating macaque:100%; Sumatran orangutan:100%; Human:100%; Dog:84%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...