LSP1 Rabbit Polyclonal Antibody
CNY 5250.00
Cited in 1 publication. |
CNY 3080.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-LSP1 antibody: synthetic peptide directed towards the N terminal of human LSP1. Synthetic peptide located within the following region: CQHERDRQLQAQDEEGGGHVPERPKQEMLLSLKPSEAPELDEDEGFGDWS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 37 kDa |
Gene Name | lymphocyte-specific protein 1 |
Database Link | |
Background | This protein is an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinogen matrix proteins, and transendothelial migration.This gene encodes an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinogen matrix proteins, and transendothelial migration. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Synonyms | pp52; WP34 |
Note | Immunogen sequence homology: Human: 100%; Guinea pig: 90%; Dog: 83% |
Reference Data |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Lymphocyte-Specific Protein-1 Controls Sorafenib Sensitivity and Hepatocellular Proliferation through Extracellular Signal-Regulated Kinase 1/2 Activation
,null,
The American Journal of Pathology
,PubMed ID 30126548
[LSP1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |