DC2L1 (DYNC2LI1) Rabbit Polyclonal Antibody
CAT#: TA330303
Rabbit Polyclonal Anti-DYNC2LI1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-DYNC2LI1 antibody is: synthetic peptide directed towards the N-terminal region of Human DYNC2LI1. Synthetic peptide located within the following region: LDRDEPPKPTLALEYTYGRRAKGHNTPKDIAHFWELGGGTSLLDLISIPI |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 22 kDa |
Gene Name | dynein cytoplasmic 2 light intermediate chain 1 |
Database Link | |
Background | DYNC2LI1 may function as a motor for intraflagellar retrograde transport and functions in cilia biogenesis. |
Synonyms | CGI-60; D2LIC; LIC3; SRTD15 |
Note | Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 86%; Mouse: 86%; Bovine: 86%; Zebrafish: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |