POLR1C Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-POLR1C antibody is: synthetic peptide directed towards the N-terminal region of Human POLR1C. Synthetic peptide located within the following region: VRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	15 kDa
Gene Name	polymerase (RNA) I subunit C
Database Link	NP_976035 Entrez Gene 9533 Human UniProt ID O15160
Background	The function of this protein remains unknown.
Synonyms	RPA5; RPA39; RPA40; RPAC1; TCS3
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 93%; Mouse: 86%; Zebrafish: 82%
Reference Data
Protein Families	Druggable Genome, Stem cell - Pluripotency, Transcription Factors
Protein Pathways	Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.