POLR1C Rabbit Polyclonal Antibody
CAT#: TA330301
Rabbit Polyclonal Anti-POLR1C Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-POLR1C antibody is: synthetic peptide directed towards the N-terminal region of Human POLR1C. Synthetic peptide located within the following region: VRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 15 kDa |
Gene Name | polymerase (RNA) I subunit C |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | RPA5; RPA39; RPA40; RPAC1; TCS3 |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 93%; Mouse: 86%; Zebrafish: 82% |
Reference Data | |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Protein Pathways | Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |