SIRT6 Rabbit Polyclonal Antibody
CAT#: TA330291
Rabbit Polyclonal Anti-SIRT6 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4537.00
CNY 3080.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human, Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SIRT6 antibody: synthetic peptide directed towards the N terminal of human SIRT6. Synthetic peptide located within the following region: STASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVG |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 39 kDa |
Gene Name | sirtuin 6 |
Database Link | |
Background | SIRT6 encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by SIRT6 is included in class IV of the sirtuin family. |
Synonyms | SIR2L6 |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 93%; Horse: 92%; Bovine: 92% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |