TAB2 Rabbit Polyclonal Antibody
CAT#: TA330285
Rabbit Polyclonal Anti-MAP3K7IP2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommend Dilution | WB, IHC |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-MAP3K7IP2 antibody: synthetic peptide directed towards the N terminal of human MAP3K7IP2. Synthetic peptide located within the following region: QKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDLNFSDDSG |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 76 kDa |
| Gene Name | TGF-beta activated kinase 1/MAP3K7 binding protein 2 |
| Database Link | |
| Background | MAP3K7IP2 is an activator of MAP3K7/TAK1, which is required for for the IL-1 induced activation of NF.:B and MAPK8/JNK. This protein forms a kinase complex with TRAF6, MAP3K7 and TAB1, thus serving as an adaptor linking MAP3K7 and TRAF6. This protein, TAB1, and MAP3K7 also participate in the signal transduction induced by TNFSF11/RANKl through the activation of the receptor activator of NF.:B (TNFRSF11A/RANK), which may regulate the development and function of osteoclasts. |
| Synonyms | CHTD2; MAP3K7IP2; TAB-2 |
| Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
| Reference Data | |
| Protein Families | Druggable Genome |
| Protein Pathways | MAPK signaling pathway, NOD-like receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
