SIRT3 Rabbit Polyclonal Antibody
CAT#: TA330279
Rabbit Polyclonal Anti-SIRT3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4381.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SIRT3 antibody: synthetic peptide directed towards the C terminal of human SIRT3. Synthetic peptide located within the following region: VGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGP |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 44 kDa |
Gene Name | sirtuin 3 |
Database Link | |
Background | SIRT3 is included in class I of the sirtuin family which is characterized by a sirtuin core domain. Human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. |
Synonyms | SIR2L3 |
Note | Immunogen sequence homology: Human: 100%; Bovine: 100%; Rabbit: 100%; Horse: 86%; Mouse: 86%; Dog: 79%; Pig: 79%; Rat: 79%; Guinea pig: 79% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |