FOXL1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FOXL1 antibody: synthetic peptide directed towards the N terminal of human FOXL1. Synthetic peptide located within the following region: HLFDPRLPALAASPMLYLYGPERPGLPLAFAPAAALAASGRAETPQKPPY
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	forkhead box L1
Database Link	NP_005241 Entrez Gene 14241 MouseEntrez Gene 2300 Human UniProt ID Q12952
Background	FOXL1 is a member of the forkhead family. The forkhead domain is a monomeric DNA binding motif that defines a rapidly growing family of eukaryotic transcriptional regulators. Genetic and biochemical data suggest a central role in embryonic development for forkhead proteins.
Synonyms	FKH6; FKHL11; FREAC7
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 92%; Rat: 86%; Mouse: 86%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.