SLC34A3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SLC34A3 antibody: synthetic peptide directed towards the middle region of human SLC34A3. Synthetic peptide located within the following region: LLERLSELALGAASLTPRAQAPDILKVLTKPLTHLIVQLDSDMIMSSATG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	63 kDa
Gene Name	solute carrier family 34 member 3
Database Link	NP_543153 Entrez Gene 142680 Human UniProt ID Q8N130
Background	SLC34A3 contributes to the maintenance of inorganic phosphate (Pi) concentration at the kidney.
Synonyms	HHRH; NPTIIc
Note	Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 85%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.