FLI1 Rabbit Polyclonal Antibody
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-FLI1 antibody: synthetic peptide directed towards the middle region of human FLI1. Synthetic peptide located within the following region: FDFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPHPSSMP |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 51 kDa |
Gene Name | Fli-1 proto-oncogene, ETS transcription factor |
Database Link | |
Background | Friend leukemia integration 1 (Fli-1) is a member of the ETS family of transcriptional regulatory proteins that contain a highly conserved and structurally unique DNA binding ETS domain. |
Synonyms | EWSR2; SIC-1 |
Note | Immunogen sequence homology: Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Human: 100%; Rabbit: 100%; Mouse: 92%; Rat: 92%; Zebrafish: 92%; African clawed frog: 85%; Horse: 85% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |