FLI1 Rabbit Polyclonal Antibody
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-FLI1 antibody: synthetic peptide directed towards the N terminal of human FLI1. Synthetic peptide located within the following region: TASGSPDYGQPHKINPLPPQQEWINQPVRVNVKREYDHMNGSRESPVDCS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 51 kDa |
Gene Name | Fli-1 proto-oncogene, ETS transcription factor |
Database Link | |
Background | FLI1 is a sequence-specific transcriptional activator. FLI1 recognizes the DNA sequence 5'-C[CA]GGAAGT-3'. |
Synonyms | EWSR2; SIC-1 |
Note | Immunogen sequence homology: Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%; African clawed frog: 85% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |