Oct-1 (POU2F1) Rabbit Polyclonal Antibody
CAT#: TA330068
Rabbit Polyclonal Anti-POU2F1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-POU2F1 antibody: synthetic peptide directed towards the N terminal of human POU2F1. Synthetic peptide located within the following region: AISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQP |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 76 kDa |
Gene Name | POU class 2 homeobox 1 |
Database Link | |
Background | POU2F1 is a member of the POU family that represents the double-stranded DNA binding proteins specifically binding to the block C region. |
Synonyms | oct-1B; OCT1; OTF1 |
Note | Immunogen sequence homology: Chicken: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Bovine: 92%; Dog: 92%; Mouse: 92%; Rat: 92%; Guinea pig: 85% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |