MMP2 Rabbit Polyclonal Antibody

CAT#: TA330021

Rabbit Polyclonal Anti-MMP2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Cited in 3 publications.

Product images

推荐一起购买 (4)
Transient overexpression lysate of matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 1
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 1, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 1, 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-MMP2 antibody: synthetic peptide directed towards the C terminal of human MMP2. Synthetic peptide located within the following region: AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 74 kDa
Gene Name matrix metallopeptidase 2
Background MMP-2 is involved in the cleavage of gelatin type I and collagen types IV, V, VII, X.
Synonyms CLG4; CLG4A; MMP-2; MMP-II; MONA; TBE-1
Note Immunogen sequence homology: Bovine: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 100%; Rabbit: 93%
Reference Data
Protein Families Druggable Genome, Protease
Protein Pathways Bladder cancer, GnRH signaling pathway, Leukocyte transendothelial migration, Pathways in cancer
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (3)

Customer Reviews 
Loading...