RAB14 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human, Murine
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RAB14 antibody: synthetic peptide directed towards the C terminal of human RAB14. Synthetic peptide located within the following region: FLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	24 kDa
Gene Name	RAB14, member RAS oncogene family
Database Link	NP_057406 Entrez Gene 51552 Human UniProt ID P61106
Background	Localized to biosynthetic and endosomal compartments, Rab14 is involved in the biosynthetic/recycling pathway between the Golgi and endosomal compartments.
Synonyms	FBP; RAB-14
Note	Immunogen sequence homology: African clawed frog: 100%; Bovine: 100%; Chicken: 100%; Dog: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 93%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.