Rabphilin 3A (RPH3A) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RPH3A antibody: synthetic peptide directed towards the N terminal of human RPH3A. Synthetic peptide located within the following region: GQPDRQRKQEELTDEEKEIINRVIARAEKMEEMEQERIGRLVDRLENMRK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	76 kDa
Gene Name	rabphilin 3A
Database Link	NP_055769 Entrez Gene 22895 Human UniProt ID Q9Y2J0
Background	RPH3A is a protein transport. RPH3A is probably involved with Ras-related protein Rab-3A in synaptic vesicle traffic and/or synaptic vesicle fusion. RPH3A could play a role in neurotransmitter release by regulating membrane flow in the nerve terminal.
Synonyms	KIAA0985
Note	Immunogen sequence homology: Bovine: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; African clawed frog: 92%; Chicken: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.