PACSIN1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PACSIN1 antibody: synthetic peptide directed towards the C terminal of human PACSIN1. Synthetic peptide located within the following region: HTTTKKEKQPKKAEGVALTNATGAVESTSQAGDRGSVSSYDRGQPYATEW
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	protein kinase C and casein kinase substrate in neurons 1
Database Link	NP_065855 Entrez Gene 29993 Human UniProt ID Q9BY11
Background	PACSIN1 may play a role in vesicle formation and transport.
Synonyms	SDPI
Note	Immunogen sequence homology: Human: 100%; Mouse: 100%; Rat: 100%; Rabbit: 92%; Dog: 85%; Goat: 85%; Horse: 85%; Pig: 85%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.