Nobox Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Nobox antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ETKNGPAAPSADSSQHRSAPELLDPMPTDLEPGPVPPENILDVFPEPPML
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	NOBOX oogenesis homeobox
Database Link	NP_570939 Entrez Gene 18291 Mouse UniProt ID Q8VIH1
Background	Nobox is a transcription factor which plays an essential role in postnatal follicle development.Nobox binds preferentially to the DNA sequences 5'-TAATTG-3', 5'-TAGTTG-3' and 5'-TAATTA-3'. Directly regulates the transcription of POU5F1 aand GDF9 during early folliculogenesis.
Synonyms	OG-2; OG2; Og2x; POF5; TCAG_12042
Note	Immunogen sequence homology: Mouse: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.