Vsx1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Vsx1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Vsx1. Synthetic peptide located within the following region: TGMRKPESEDKLAGLWEFDHLKKGANKDEDGPERGPDETTQNPENSLEDV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	visual system homeobox 1
Database Link	NP_473409 Entrez Gene 114889 Mouse UniProt ID Q91V10
Background	Vsx1 binds to the 37-bp core of the locus control region (LCR) of the red/green visual pigment gene cluster. Vsx1 may regulate the activity of the LCR and the cone opsin genes at earlier stages of development.
Synonyms	KTCN; PPCD; PPD; RINX
Note	Immunogen sequence homology: Rat: 100%; Mouse: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.