Foxp3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Foxp3 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Foxp3. Synthetic peptide located within the following region: LPSWKTAPKGSELLGTRGSGGPFQGRDLRSGAHTSSSLNPLPPSQLQLPT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	forkhead box P3
Database Link	NP_473380 Entrez Gene 20371 Mouse UniProt ID Q99JB6
Background	Foxp3 is a probable transcription factor. It plays a critical role in the control of immune response.
Synonyms	AIID; DIETER; FOXP3delta7; IPEX; JM2; MGC141961; MGC141963; PIDX; SCURFIN; XPID
Note	Immunogen sequence homology: Rat: 100%; Mouse: 100%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.